List of products by brand Biorbyt

Biorbyt

Explore. Bioreagents

Based in Cambridge, one of Europe’s largest bioscience hubs, Biorbyt has a simple yet challenging mission: to provide the best service to the global scientific community. In cooperation with researchers and academics worldwide, Biorbyt develops biochemicals, antibodies and immunoassays of the highest quality.


Product Range:

  • Antibodies: monoclonal and polyclonal, primary and secondary, conjugates (FITC, HRP, Gold)
  • ELISA kits for research and for food diagnostics
  • Proteins and enzymes
  • Small molecules: biochemical and chemical molecules, peptides i.a.
  • Biology Tools: DNA, serums and cell lysates, agarose, detection kits i.a.

 

http://www.biorbyt.com

  • Show Sidebar

(DANRE)edf1 antibody

| Name: Primary antibodies | Name: (DANRE)edf1 antibody | Immunogen: KLH conjugated synthetic peptide between 122-146 amino acids from the C-terminal region of (DANRE)edf1.| Tested application:WB | Application dilute:WB: 1:1000 | Reacts with: Zebrafish| Conjugation: Unconjugated| Host: Rabbit| Clonality: Polyclonal| Clone: | Isotype: IgG| Quotation request

0HSD17B7 antibody

| Name: Primary antibodies | Name: 0HSD17B7 antibody | Immunogen: Recombinant Protein| Tested application:WB | Application dilute: | Reacts with: Human| Conjugation: Unconjugated| Host: Rabbit| Clonality: Polyclonal| Clone: | Isotype: IgG| Quotation request

1110059E24Rik antibody

| Name: Primary antibodies | Name: 1110059E24Rik antibody | Immunogen: Synthetic peptide located within the following region: KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP| Tested application:WB | Application dilute: | Reacts with: Human, Mouse, Rat, Zebrafish, Guinea Pig, Dog, Horse| Conjugation: Unconjugated| Host: Rabbit| Clonality: Polyclonal| Clone: | Isotype: IgG| Quotation request